Diamine N-acetyltransferase 1, 1-171 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Diamine N-acetyltransferase 1(or Spermidine/spermine-N1-acetyltransferase, SSAT1), as known as SAT-1, is a polyamine catabolic enzyme which catalyzes the acetylation of polyamines. This protein plays an important role in polyamine homoeostasis, since acetylated products are either excreted from the cell or oxidized by acetylpolyamine oxidase.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01878
Size 100 µg
Host E.coli
Accession
Molecular Weight 22.1 kDa (191aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing, 10% glycerol
Other Names spermidine/spermine N1-acetyltransferase 1, SSAT1, DC21, KFSD, KFSDX, SAT
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap