Home / Products / proteins / DHH, 23-198aa, Human, His-tagged, Recombinant, E.coli

DHH, 23-198aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
DHH belongs to the hedgehog family. The C-terminal domain displays an autoproteolysis activity and a cholesterol transferase activity. The N- terminal domain is the active species in both local and longrange signaling, whereas the C-terminal domain has no signaling activity.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01873
Size 100 µg
Host E.coli
Accession
Molecular Weight 22.0kDa (197aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG
Purity > 95% by HPLC
Concentration 1 mg/ml
Formulation Liquid in 20mM MES pH 5.5, 0.5mM DTT, 20% glycerol
Other Names desert hedgehog preproprotein, Drosophila, HHG-3, MGC35145, Desert hedgehog protein N-product
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap