DHFR, 1-187 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
DHFR, also known as Dihydrofolate reductase, is an enzyme that reduces dihydrofolic acid to tetrahydrofolic acid, using NADPH as electron donor, which can be converted to the kinds of tetrahydrofolate cofactors used in 1-carbon transfer chemistry. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia. Recombinant Dihydrofolate reductase protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01870
Size 100 µg
Host E.coli
Accession
Molecular Weight 23.6 kDa (207aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMVGSLNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKEPPQGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 2mM DTT, and 30% glycerol
Other Names Dihydrofolate reductase
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap