Home / Products / proteins / DBNDD2, 1-161aa Human, His tag, E.coli

DBNDD2, 1-161aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
DBNDD2, also known as dysbindin domain-containing protein 2, belongs to the dysbindin family. DBNDD2 may modulate the activity of casein kinase-1 and inhibits CSNK1D autophosphorylation (in vitro). Recombinant human DBNDD2 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01833
Size 50 µg
Host E.coli
Accession
Molecular Weight 20.1 kDa (185aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMDPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS
Purity > 95% by HPLC
Concentration 0.5 mg/ml
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 0.1M NaCl, 1mM DTT
Other Names Dysbindin domain-containing protein 2, C20orf35, CK1BP, HSMNP1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap