DBNDD1, 1-158aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
DBNDD1 also known as dysbindin domain-containing protein 1, belongs to the dysbindin family. Recombinant human DBNDD1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01832
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.6 kDa (182aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMEPPEGAGTGEIVKEAEVPQAALGVPAQGTGDNGHTPVEEEVGGIPVPAPGLLQVTERRQPLSSVSSLEVHFDLLDLTELTDMSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPERQATVLDTFLTVERPQED
Purity > 95% by HPLC
Concentration 0.5 mg/ml
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol, 0.1M NaCl, 1mM DTT
Other Names Dysbindin domain-containing protein 1 isoform 1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap