Home / Products / proteins / Cyclophilin A, 1-165 aa, Human, Recombinant, E.coli

Cyclophilin A, 1-165 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Cyclophilin A (also known as Peptidylprolyl isomerase A, PPIA) encodes a member of the peptidyl-prolyl cis-trans isomerase family. They are highly-conserved cytoplasmic enzymes that accelerate protein folding. Cyclophilin A is also incorporated into many viruses, including HIV-1, where it has been speculated to be involved in functions such as viral assembly and infectivity.
List Price: $307
  • Buy 5 for $291.65 each and save 5%
  • Buy 21 for $276.3 each and save 10%
  • Buy 31 for $260.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01808
Size 100 µg
Host E.coli
Accession
Molecular Weight 20kDa (185aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 20 mM NaCl, 0.5 mM DTT, 10% glycerol
Other Names Peptidylprolyl isomerase A, PPIA, CYPA, CYPH
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap