Home / Products / proteins / CXCL3/GRO γ, 35-107aa, Human, His-Tagged, Recombinant, E.coli

CXCL3/GRO γ, 35-107aa, Human, His-Tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
CXCL3/GROg is a small cytokine belonging to the CXC chemokine family. CXCL3 controls migration and adhesion of monocytes and mediates it effects on its target cell by interacting with a cell surface chemokine receptor called CXCR2. Recombinant human CXCL3 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $167
  • Buy 5 for $158.65 each and save 5%
  • Buy 21 for $150.3 each and save 10%
  • Buy 31 for $141.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01800
Size 50 µg
Host E.coli
Accession
Molecular Weight 10.1kDa (94aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT, 20% glycerol
Other Names Chemokine (C-X-C motif) ligand 3,CINC-2b, GRO3, GROg, MIP-2b, MIP2B, SCYB3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap