CXCL2, 35-107 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
CXCL2 is a small cytokine belonging to the CXC chemokine family that is also known as Chemokine (C-X-C motif) ligand 2, and macrophage inflammatory protein 2-alpha (MIP2-alpha). CXCL2 is secreted by activated monocytes, neutrophils and macrophages and expressed at sites of inflammation.
List Price: $167
  • Buy 5 for $158.65 each and save 5%
  • Buy 21 for $150.3 each and save 10%
  • Buy 31 for $141.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01798
Size 100 µg
Host E.coli
Accession
Molecular Weight 10.1 kDa (94aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0)
Other Names C-X-C motif chemokines 2,MIP2-alpha, Gro-beta, CINC-2a, GRO2, GROb, MIP2, MIP2A, SCYB2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap