CXCL17, 22-119aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
Chemokine (C-X-C motif) ligand 17, also known as CXCL17, is a small cytokine belonging to the CXC chemokine family. CXCL17 is a 119 amino acid secreted protein that plays a role in angiogenesis. CXCL17 is expressed in skeletal muscle, trachea, lung, intestine and stomach, and is upregulated in duodenal mucosa of patients with acute cholera, as well as breast tumors. CXCL17 is considered a housekeeping chemokine for the movement of immature dendritic cells and non activated blood monocytes into tissues, and is thought to be involved in the innate immune response. Recombinant human CXCL17 protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $357
  • Buy 5 for $339.15 each and save 5%
  • Buy 21 for $321.3 each and save 10%
  • Buy 31 for $303.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01797
Size 50 µg
Host E.coli
Accession
Molecular Weight 13.7 kDa (119aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 10% glycerol
Other Names Chemokine (C-X-C motif) ligand 17 , Dcip1, DMC, MGC138300, UNQ473, VCC-1, VCC1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap