Home / Products / proteins / CXCL13, 23-109aa, Human, His tag, E.coli

CXCL13, 23-109aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
B lymphocyte chemoattractant, independently cloned and named Angie, is a CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles. Recombinant human CXCL13 protein, fused to His-tag at N-terminus, was expressed in E.coli
List Price: $213
  • Buy 5 for $202.35 each and save 5%
  • Buy 21 for $191.7 each and save 10%
  • Buy 31 for $181.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01796
Size 100 µg
Host E.coli
Accession
Molecular Weight 12.7kDa (110aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing , 10% glycerol, 0.4M Urea
Other Names C-X-C motif chemokine 13 precursor, Chemokine (C-X-C motif) ligand 13, ANGIE, ANGIE2, BCA-1, BCA1, BLC, BLR1L, SCYB13
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap