Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP01770 |
Size | 50 µg |
Host | Baculovirus |
Accession | |
Molecular Weight | 14.6kDa (135aa), 18-28KDa (SDS-PAGE under reducing conditions.) |
AP_Mol_Weight | |
Tag | N-6His |
Sequences | ADLKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDHHHHHH |
Purity | > 95% by HPLC |
Concentration | 0.25mg/ml (determined by Absorbance at 280nm) |
Formulation | Liquid. In Phosphate Buffered Saline (pH 7.4) containing 20% glycerol. |
Other Names | Cytotoxic T-lymphocyte-associated protein 4, ALPS5, CD, CD152, CELIAC3, CTLA-4, GRD4, GSE, IDDM12 |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap