CTLA4, 36-161aa, Human, His tag, Baculovirus

Categories: [Proteins / Peptides]
CTLA4, also known as cytotoxic T-lymphocyte-associated protein 4, is a co-inhibitory molecule expressed on T cells that mediates the inhibition of T-cell function. This protein is a crucial immune regulator that mediates both negative costimulation signals to T cells, and regulatory T (Treg)-cell extrinsic control of effector responses. It has been implicated in several autoimmune diseases, such as systemic lupus erythematosus. Recombinant human CTLA4, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $232
  • Buy 5 for $220.4 each and save 5%
  • Buy 21 for $208.8 each and save 10%
  • Buy 31 for $197.2 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01770
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 14.6kDa (135aa), 18-28KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences ADLKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 20% glycerol.
Other Names Cytotoxic T-lymphocyte-associated protein 4, ALPS5, CD, CD152, CELIAC3, CTLA-4, GRD4, GSE, IDDM12
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap