Home / Products / proteins / CTLA4, 36-161aa, Human, hIgG-His tag, Baculovirus

CTLA4, 36-161aa, Human, hIgG-His tag, Baculovirus

Categories: [Proteins / Peptides]
CTLA4, also known as cytotoxic T-lymphocyte protein 4 isoform CTLA4-TM, is a type I transmembrane T cell inhibitory molecule that is a member of the Ig superfamily. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. Recombinant human CTLA4, fused to hIgG His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $232
  • Buy 5 for $220.4 each and save 5%
  • Buy 21 for $208.8 each and save 10%
  • Buy 31 for $197.2 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01769
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 40.8kDa (368aa); 40-57KDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences ADLKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Cytotoxic T-lymphocyte protein 4 isoform CTLA4-TM, CTLA4, ALPS5, CD, CD152, CELIAC3, CTLA-4, GRD4, GSE, IDDM12
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap