Crystallin α B, 1-175aa, Mouse, Recombinant, E.coli

Categories: [Proteins / Peptides]
Alpha crystallins are composed of two gene products, alpha-A and alpha-B for acidic and basic, respectively. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (sHSP also known as the HSP20).
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01731
Size 100 µg
Host E.coli
Accession
Molecular Weight 20kDa (175aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWIDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVAAAPKK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Other Names Crya2, Crya-2, Cryab
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap