Home / Products / proteins / COMMD6, 1-85aa, Human, His tag, E.coli

COMMD6, 1-85aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
COMMD6 contains 1 COMM domain. This protein down-regulates activation of NF-kappa-B and inhibits TNF-induced NFKB1 activation. Recombinant human COMMD6 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01680
Size 100 µg
Host E.coli
Accession
Molecular Weight 12.0 kDa(108aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETV
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH7.0) containing 20% glycerol 0.15M NaCl, 1mM DTT
Other Names COMM domain-containing protein 6 isoform b, Acrg
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap