Home / Products / proteins / CHP, 1-195aa, Human, His tag, E.coli

CHP, 1-195aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CHP (Calcium-binding protein P22) is a phosphoprotein that binds to the sodium-hydrogen exchangers (NHEs). This protein serves as an essential cofactor which supports the physiological activity of NHE family members. It has protein sequence similarity to calcineurin B and it is also known to be an endogenous inhibitor of calcineurin activity.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01613
Size 100 µg
Host E.coli
Accession
Molecular Weight 24.7 kDa(216aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMMGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl Buffer (pH 7.5) containing 10% Glycerol
Other Names Calcium-binding protein p22, SLC9A1BP, Calcineurin B homolog, Calcineurin homologous protein
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap