CGB3, 21-165aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
CGB3, also known as choriogonadotropin subunit beta, is a member of the glycoprotein hormone beta chain family and encodes the beta 3 subunit of chorionic gonadotropin (CG). It stimulates the expression of GCM1 target genes, including the fusogenic protein syncytin-1, to promote placental cell fusion. It synthesized in large quantities by the developing placenta, reaching peak concentrations in maternal blood during the late first trimester and early midtrimester of pregnancy. It is expressed exclusively by trophoblasts. It is an important biomarker in pregnancy and oncology, where it is routinely detected and quantified by specific immunoassays. Recombinant human CGB3, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01597
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 16.6kDa (154aa)18-28kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag
Sequences ADPSKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Choriogonadotropin subunit beta, CGB3, CGB, CGB5, CGB7, CGB8, hCGB
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap