CDK16, 158-496 aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Cyclin-dependent kinase 16 isoform 1, also known as CDK16, belong to the CDK family of serine/threonine protein kinases. These proteins have a core kinase domain flanked by unique amino- and carboxy-terminal domains. CDK proteins are known to regulate the cell cycle. CDK16, which is expressed primarily in mammalian brain, interacts with a variety of proteins, and is thought to be part of a multiple signal transduction cascade. Recombinant human CDK16 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $276
  • Buy 5 for $262.2 each and save 5%
  • Buy 21 for $248.4 each and save 10%
  • Buy 31 for $234.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01555
Size 100 µg
Host E.coli
Accession
Molecular Weight 41.1 kDa (362aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNIINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGILSNEEFKTYNYPKYRAEALLSHAPRLDSDGADLLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPDSGRPAFRVVDTEF
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 10% glycerol
Other Names Cyclin-dependent kinase 16 isoform 1, PCTAIRE, PCTAIRE1, PCTGAIRE, PCTK1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap