CD93, 22-580aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
CD93, also known as complement component C1q receptor, belongs to a family of transmembrane glycoproteins which also includes endosialin and thrombomodulin. It is involved in various aspects of inflammatory reactions. CD93 is expressed by vascular endothelial cells and by a variety of hematopoietic cells. It is receptor for C1q, mannose-binding lectin (MBL2) and pulmonary surfactant protein A (SPA). Recombinant human CD93, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01542
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 59.3kDa (567aa), 70-100KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKVEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol
Other Names Complement component C1q receptor , CD93, C1qR(P), C1QR1, C1qRP, CDw93, dJ737E23.1, ECSM3, MXRA4, C1q receptor 1C1q/MBL/SPA receptor, C1qR, C1qR(p), C1qr1C1QR1_HUMAN.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap