CD84, 22-225aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
CD84, also known as slam family member 5 isoform 1, is a self-binding receptor from the CD150 family that is broadly expressed in hematopoietic cells. It is highly expressed in mast cells and that it contributes to the regulation of Fc?RI signaling in SAP- and EAT-2-independent and Fes- and Src homology region 2 domain-containing phosphatase-1-dependent mechanisms. It belongs to the signaling lymphocyte activating molecule family of immunoreceptors, and has an unknown function in CLL cells. Its expression is significantly elevated from the early stages of the disease, and is regulated by macrophage migration inhibitory factor and its receptor, CD74. Recombinant human CD84, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $357
  • Buy 5 for $339.15 each and save 5%
  • Buy 21 for $321.3 each and save 10%
  • Buy 31 for $303.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01539
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 23.8kDa (213aa) 28-40kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag
Sequences ADPKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGHHHHHH
Purity > 95% by HPLC
Concentration 1.0mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names SLAM family member 5 isoform 1, CD84, hCD84, LY9B, mCD84, SLAMF5
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap