CD7, 26-180aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
CD7, also known as T-cell antigen CD7, is glycosylated and palmitoylated transmembrane protein in the immunoglobulin superfamily. It is expressed on T cells, NK cells, myeloid progenitor cells, and CD19+ B progenitor cells. Among CD8+ T cells, the CD7-bright population preferentially contains naive and memory cells, while more weak expressors are primarily effector cells. Recombinant human CD7 protein, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $357
  • Buy 5 for $339.15 each and save 5%
  • Buy 21 for $321.3 each and save 10%
  • Buy 31 for $303.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01529
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 17.5kDa (645aa), 18-28KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADLAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPHHHHHH
Purity > 95% by HPLC
Concentration 1.0mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names T-cell antigen CD7, CD7, GP40, LEU-9, Tp40, TP41
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap