Home / Products / proteins / CD58, 29-215aa Human, His tag, E.coli

CD58, 29-215aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
CD58 is a member of the immunoglobulin superfamily. This protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. CD58 is localized to the plasma membrane. Alternatively spliced transcript variants have been described. Recombinant human CD58 protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $397
  • Buy 5 for $377.15 each and save 5%
  • Buy 21 for $357.3 each and save 10%
  • Buy 31 for $337.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01523
Size 100 µg
Host E.coli
Accession
Molecular Weight 23.8kDa (210aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Phosphate buffer containing 10% glycerol
Other Names CD58 molecule, ag3, LFA-3, LFA3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap