Home / Products / proteins / B2M, 21-119aa, Human, His tag, E.coli

B2M, 21-119aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Beta2 microglobulin, also known as B2M, is a component of MHC class I molecules, Involved in the presentation of peptide antigens to the immune system. B2M is a protein found on the surface of many cells and plentiful on the surface of white blood cells
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01283
Size 10 µg
Host E.coli
Accession
Molecular Weight 14.0kDa (120aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 2mM DTT, 100mM NaCl
Other Names Beta-2-microglobulin
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap