| Data Sheet | Click for Datasheet |
|---|---|
| Catalog Number | TP01136 |
| Size | 100 µg |
| Host | E.coli |
| Accession | |
| Molecular Weight | 35.8kDa (316aa) , confirmed by MALDI-TOF |
| AP_Mol_Weight | |
| Tag | |
| Sequences | MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF |
| Purity | > 95% by HPLC |
| Concentration | 1 mg/ml (determined by Bradford assay) |
| Formulation | Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 1mM DTT, 10% glycerol |
| Other Names | Aldo-keto reductase family1, member B1; AKR1B1; ADR; ALDR1; ALR2; AR. |
| Bioactivity | |
| Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
| Postscript | For research use only, not for use in diagnostic procedures. |
Featured Products
- STK3, 1-322aa, Human, His-tag, Baculovirus
- Human MIP-5(Macrophage Inflammatory Protein 5) ELISA Kit
- Human MIF(Macrophage Migration Inhibitory Factor) ELISA Kit
- Human FZD8(Frizzled Homolog 8) ELISA Kit
- Human PDCD1(Programmed Cell Death Protein 1) ELISA Kit
- Human CRHBP(Corticotropin Releasing Hormone Bingding Protein) ELISA Kit
- Human αHSP(Alpha-Hemoglobin Stabilizing Protein) ELISA Kit
- Human MMP-28(Matrix Metalloproteinase 28) ELISA Kit
- Human TLR4(Toll-Like Receptor 4) ELISA Kit
- Human SPTAN1(Alpha-Fodrin) ELISA Kit
- Human AZGP1(Zinc-alpha-2-glycoprotein) ELISA Kit
- Human MSLN(Mesothelin) ELISA Kit
- Human SOST(Sclerostin) ELISA Kit
- Mab21 Domain Containing Protein 1 (MB21D1)
- Coiled Coil Domain Containing Protein 60 (CCDC60)
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap