ZWINT, 1-230aa

Categories: [Proteins / Peptides]
ZW10 interactor isoform b, also known as ZWINT, is clearly involved in kinetochore function. Localized to the cytoplasm during interphase and to kinetochores from late prophase to anaphase, ZWINT interacts with ZW10 (Zeste White 10) and functions to regulate the association between ZW10 and kinetochores. Defects in the gene encoding ZWINT are associated with the pathogenesis of Roberts’s syndrome, an autosomal recessive disorder characterized by growth retardation due to premature chromosome separation. Recombinant human ZWINT protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04545
Size 20 µg
Host
Accession
Molecular Weight 27.9 kDa (253aa) confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMGSMEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVADFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEGKLLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLP
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 20% glycerol, 1mM DTT
Other Names HZwint-1, KNTC2AP, ZWINT1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap