Vasostatin 2, 19-131aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Vasostatin 2 is the N-terminal fragment (19-131 aa) derived from the cleavage of chromogranin A (CgA) which is a member of the chromogranin/secretogranin(granins) family of neuroendocrine secretory proteins. Vasostatin 2 has been shown to exert several biological activities on several tissues and organs and exerts a large spectrum of homeostatic actions, including antifungal and antimicrobial effect, modulation of cell adhesion, and inhibition of parathyroid hormone secretion. Recombinant human Vasostatin 2 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04457
Size 100 µg
Host E.coli
Accession
Molecular Weight 12.8 kDa (114aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MLPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVME
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Other Names Chromogranin A, Vasostatin 2, beta Granin, CGA, CHG A, CHGA, ChromograninA, Chromogranin A parathyroid secretory protein 1, Chromogranin A precursor, Pancreastatin, Parastatin, Parathyroid secretory protein 1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap