UPP1, 1-310aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Uridine phosphorylase 1, also known as UPP1 catalyses the reversible phosphorolysis of uridine to uracil. The reaction products are then utilized as carbon and energy sources, or in the rescue of pyrimidine bases for nucleotide synthesis. The expression levels and the enzymatic activity of UPP1 are higher in human solid tumors than in adjacent normal tissues. In addition, UPP1 controls the homeostatic regulation of uridine concentration in plasma and tissues and plays a role in the intracellular activation of 5-fluorouracil. Recombinant human UPP1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04433
Size 50 µg
Host E.coli
Accession
Molecular Weight 36 kDa (330aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYYARCSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 40% glycerol, 200mM NaCl
Other Names Uridine phosphorylase 1, UP, UPASE, UPP, UrdPase 1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap