UPK3A, 19-207aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
UPK3A belongs to the uroplakin-3 family. Uroplakins (UP) are key components of the urothelium. They are transmembrane proteins that pass the lipid bilayer once (UPII, UPIIIa, and UPIIIb) or four times (UPIa and UPIb; both belonging to the 'tetraspanin' family). All have large luminal/extracellular domains, but only UPIIIa and UPIIIb have significant cytoplasmic portions in their C-termini. UPK3A is a highly specific and moderately sensitive immunohistochemical marker for primary and metastatic urothelial carcinomas. Mutations in this gene may be associated with renal adysplasia Recombinant human UPK3A protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04432
Size 50 µg
Host E.coli
Accession
Molecular Weight 23.1kDa (214aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMVNLQPQLASVTFATNNPTLTTVALEKPLCMFDSKEALTGTHEVYLYVLVDSAISRNASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDLPSLDAIGDVSKASQILNAYLVRVGANGTCLWDPNFQGLCNPPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTPYSTIDTWPGRRSGG
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2mM DTT, 20% glycerol, 150mM NaCl
Other Names Uroplakin-3a, UPK3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap