UFC1, 1-167aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
UFC1 is an E2-like conjugating enzyme for ubiquitin-fold modifier-1. UFM1 is activated by a novel E1-like enzyme, UBA5, by forming a high-energy thioester bond. Activated UFM1 is then transferred to its cognate E2-like enzyme, UFC1, in a similar thioester linkage. Recombinant human UFC1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04416
Size 100 µg
Host E.coli
Accession
Molecular Weight 21.6 kDa (187aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 0.1M NaCl,1mM DTT
Other Names Ubiquitin-fold modifier-conjugating enzyme 1, HSPC155
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap