UCHL5, 1-329aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Ubiquitin carboxyl-terminal hydrolase isozyme L5 (UCHL5) belongs to the peptidase C12 family. This protein is protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains, and deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Recombinant human UCHL5 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04412
Size 100 µg
Host E.coli
Accession
Molecular Weight 39.7kDa (349aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 5mM DTT, 30% glycerol, 200mM NaCl, 0.1mM PMSF, 2mM EDTA
Other Names Ubiquitin carboxyl-terminal hydrolase isozyme L5, Ubiquitin carboxyl-terminal hydrolase isozyme L5, UCH37, UCH-L5, AD-019, CGI-70, INO80R, INO80 complex subunit R
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap