Uchl3, 1-230aa, Mouse, His tag, Baculovirus (Bioactivity Validated)

Categories: [Proteins / Peptides]
Uchl3, as known as ubiquitin carboxyl-terminal hydrolase isozyme L3, is a member of the peptidase C12 family of deubiquitinating enzymes. It is widely expressed with the highest levels being observed in heart, testis, thymus and striated muscle. This protein is suggested to function in the central nervous system. In particular, it is involved in the maintenance of neurons of the gracile tract, nucleus tractus, solitaris, and area postrema, and in working memory. Recombinant mouse Uchl3, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $154
  • Buy 5 for $146.3 each and save 5%
  • Buy 21 for $138.6 each and save 10%
  • Buy 31 for $130.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04411
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 27.2 kDa (238aa), 28-40kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAALEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Ubiquitin carboxyl-terminal hydrolase isozyme L3, Uchl3, Ubiquitin carboxyl-terminal esterase L3, Ubiquitin thioesterase L3, Ubiquitin thiolesterase, Ubiquitin thiolesterase L3, UCH L3, UCH-L3, UCHL3, UCHL3_HUMAN.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap