UBL5, 1-73aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
UBL5, also known ubiquitin-like protein 5, is thought to be reversible modulators of protein function rather than protein degraders like ubiquitin. This protein effects a nuclear step required for mounting a response to the threat of mitochondrial protein misfolding. Recombinant human UBL5 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04403
Size 100 µg
Host E.coli
Accession
Molecular Weight 10.7 kDa (93aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 0.1M NaCl,2mM DTT
Other Names Ubiquitin-like protein 5, 1110030M22Rik, beacon
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap