UBL3, 1-114aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
UBL3, also known as PNSC1, is a 117 amino acid membrane protein belonging to the ubiquitin-like family. This protein contains two potential N-glycosylation sites, a potential protein kinase C phosphorylation site and a potential C-terminal prenylation site. Ubiquitin-like proteins are not directly involved in protein degradation, but appear to have many mechanistic similarities with the ubiquitin pathway. Recombinant human UBL3 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04401
Size 100 µg
Host E.coli
Accession
Molecular Weight 15.0 kDa (134aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCC
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by BCA)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 20% glycerol, 2mM DTT, 0.1M NaCl.
Other Names Ubiquitin-like protein 3, DKFZp434K151, FLJ32018, HCG-1, PNSC1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap