UBE2T, 1-197 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
UBE2T, also known as PIG50 or HSPC150, is a member of the E2 ubiquitin-conjugating enzyme family Involved in the protein degradation pathway. This protein catalyzes the ATP-dependent attachment of ubiquitin (Ub) to target proteins, thereby tagging them for subsequent destruction by the proteasome. Additionally, UBE2T is thought to be a crucial component of the Faconi anemia pathway of DNA damage repair and, upon self-inactivation, may negatively regulate the Faconi pathway. Recombinant UBE2T protein, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04396
Size 100 µg
Host E.coli
Accession
Molecular Weight 23.6 kDa (205aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDVLEHHHHHH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol 1mM DTT.
Other Names HSPC150, PIG50, Ubiquitin-conjugating enzyme E2T Cell proliferation inducing gene 50 protein, HSPC150 protein similar to ubiquitin conjugating enzyme, HSPC150 protein similar to ubiquitin-conjugating enzyme, UBE2T
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap