Home / Products / proteins / UBE2S, 1-222 aa, Human, His-tagged, Recombinant, E.coli

UBE2S, 1-222 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
UBE2S, also known as ubiquitin-conjugating enzyme E2S, is a member of the ubiquitin-conjugating enzyme family. This protein is able to form a thiol ester linkage with ubiquitin in an ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins. It catalyzes the covalent attachment of ubiquitin to other proteins. Recombinant UBE2S protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04395
Size 100 µg
Host E.coli
Accession
Molecular Weight 27.9 kDa (258aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 1mM DTT and 20% glycerol
Other Names E2-EPF, E2EPF, EPF5, Ubiquitin-conjugating enzyme E2S AA409170, MGC101982, UBE2S, Ubiquitin carrier protein S, Ubiquitin protein ligase S, Ubiquitin conjugating enzyme E2 24 kD, Ubiquitin conjugating enzyme E2S,
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap