UBE2N, 1-152aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
UBE2N, also known as UBC13, is a member of the E2 ubiquitin-conjugating enzyme family. It catalyzes the ATP-dependent synthesis of non-canonical polyubiquitin chains, a process that does not lead to proteasomal degradation. It mediates the transcription of several target genes and is thought to play a role in cell cycle progression; cellular differentiation and DNA repair mechanisms that ensure cell survival after DNA damage. Recombinant human UBE2N protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04392
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.3 kDa(172aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, Q10010.1M NaCl,1mM DTT
Other Names Ubiquitin-conjugating enzyme E2 N, MGC131857, MGC8489, UBC13, UbcH-ben
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap