UBE2G2, 1-165aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
UBE2G2 also known as Ubiquitin-conjugating enzyme E2 G2 isoform 1. The modification of UBE2G2 with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. UBE2G2 is ubiquitously expressed, with high expression seen in adult muscle. Recombinant human UBE2G2, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04386
Size 100 µg
Host E.coli
Accession
Molecular Weight 21kDa (188aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate buffered saline (pH7.4) containing 10% glycerol, 1mM DTT
Other Names Ubiquitin-conjugating enzyme E2 G2 isoform 1 , UBC7
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap