Home / Products / proteins / TXNRD3NB, 1-133aa, Human, His tag, E.coli

TXNRD3NB, 1-133aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
TXNRD3NB is expressed in pancreas, esophagus, bone marrow and keratinocytes. This protein shares overlapping exons with TXNRD3. The initiation codon is found in exon 3 of the TXNRD3IT1 gene. Recombinant human TXNRD3NB protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04362
Size 20 µg
Host E.coli
Accession
Molecular Weight 16.7 kDa (156aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMRDLSERRLGQPELKAEQQMPLEPVRARLSVGLACCCSHTTAEASSLEHGDKVFGQGFPSPLEEIKRLLKISRALQARSVPSTQEKAKCLSGEPGQPEGKGQETYPGPGKVEGKAEPAMRKDDVCPGMKCISG
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl(pH 8.0) containing 30% glycerol, 0.15M NaCl, 1mM DTT
Other Names Thioredoxin reductase 3 neighbor, TR2IT1, TXNRD3IT1, TXNRD3NT1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap