TXNL4A, 1-142aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Thioredoxin-like 4A, also known as TXNL4A, belongs to the Dim protein family. TXNL4A is a 142 amino acid protein that plays an essential role in pre-mRNA splicing. Due to a failure to express early zygotic transcripts, deletion of the gene encoding TXNL4A in Schizosaccharomyces pombe leads to embryonal lethality during gastrulation. Localized to the nucleus, TXNL4A interacts with hnRNP F, hnRNP H2, Cas-L and PQBP-1 to effect gene expression. Recombinant human TXNL4A protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04358
Size 50 µg
Host E.coli
Accession
Molecular Weight 19.3 kDa (166aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 20% glycerol, 1mM DTT
Other Names Thioredoxin-like 4A, DIB1, DIM1, HsT161, TXNL4, U5-15kD
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap