TXN, 1-105 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
SQSTM1 is an adapter protein which binds ubiquitin and regulates signaling cascades through ubiquitination. It may regulate the activation of NFKB1 by TNF-alpha, nerve growth factor (NGF) and interleukin-1 and play a role in titin/TTN downstream signaling in muscle cells. This protein also may be involved in cell differentiation, apoptosis, immune response and regulation of K+ channels. Mutations in the ubiquitin-associated (UBA) domain of the sequestosome 1 protein commonly cause Paget's disease since the UBA is necessary for aggregate sequestration and cell survival. Recombinant SQSTM1 protein, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04354
Size 100 µg
Host E.coli
Accession
Molecular Weight 13.9 kDa (125aa), confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by BCA assay)
Formulation Liquid. In Phosphate Buffered Saline pH7.4
Other Names TRX, TRX1, Thioredoxin JW0871, ECK0879, Thioredoxin reductase, FAD/NAD(P)-binding, TRXR.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap