Tumor necrosis factor receptor superfamily member 9, 24-187aa, Mouse, His tag, Insect cell

Categories: [Proteins / Peptides]
TNFRSF9, also known as tumor necrosis factor receptor superfamily member 9, interacts with TNFSF9 expressed on activated T cells and delivers a co-stimulatory signal for T cell activation and growth. It binds with high affinity to the transmembrane TNFSF9(4-1BB ligand) which expressed on antigen presenting cells and myeloid progenitor cells. Recombinant mouse TNFRSF9, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $357
  • Buy 5 for $339.15 each and save 5%
  • Buy 21 for $321.3 each and save 10%
  • Buy 31 for $303.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04348
Size 20 µg
Host Insect cell
Accession
Molecular Weight 18.6kDa (172aa) 18-28KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Tnfrsf9, 4-1BB ligand receptor, T-cell antigen 4-1BB, CD antigen: CD137, Cd137, Ila, Ly63
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap