Tumor necrosis factor receptor superfamily member 8, 19-379aa, Human, His tag, Insect cell

Categories: [Proteins / Peptides]
TNFRSF8, also known as Tumor necrosis factor receptor superfamily member 8, is receptor for TNFSF8/CD30L. It may play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Also, this protein regulates gene expression through activation of NF-kappa-B. As a regulator of apoptosis, TNFRSF8 induces cell death or proliferation, depending on the cell type. Recombinant human TNFRSF8, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $216
  • Buy 5 for $205.2 each and save 5%
  • Buy 21 for $194.4 each and save 10%
  • Buy 31 for $183.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04347
Size 50 µg
Host Insect cell
Accession
Molecular Weight 39.5kDa (370aa) 40-57KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences ADPFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKHHHHHH
Purity > 95% by HPLC
Concentration 1.0mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names TNFRSF8, CD30L receptor, Ki-1 antigen, Lymphocyte activation antigen CD30, CD30
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap