Tumor necrosis factor receptor superfamily member 6, 26-173aa, Human, His tag, Insect cell

Categories: [Proteins / Peptides]
FAS, also known as tumor necrosis factor receptor superfamily member 6, belongs to the death receptor subfamily of the TNF receptor superfamily and is designated TNFRSF6. This protein plays a major role in controlling viral infections. While FAS is expressed on most cell types, its cognate ligand (FasL) is restricted to activated T, NK and dendritic cells. The upregulation of FasL and TRAIL on HCMV-infected dendritic cells promotes direct killing of activated T lymphocytes, an action that may preferentially delete HCMV-specific T cells. Moreover, the activation of FasL on HCMVinfected retinal pigment epithelial cells may subvertneutrophil function in HCMV retinitis. Recombinant human FAS, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04346
Size 50 µg
Host Insect cell
Accession
Molecular Weight 17.7kDa (156aa), 18-28KDa (SDS-PAGE under reducing conditions.),
AP_Mol_Weight
Tag N-6His
Sequences QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names FAS, ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap