Home / Products / proteins / Tumor necrosis factor receptor superfamily member 5, 20-193aa, Mouse, His tag, Insect cell

Tumor necrosis factor receptor superfamily member 5, 20-193aa, Mouse, His tag, Insect cell

Categories: [Proteins / Peptides]
CD40, also known as tumor necrosis factor receptor superfamily member, is receptor for TNFSF5/CD40LG. It transduces TRAF6 and MAP3K8 mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion. Recombinant mouse CD40, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $357
  • Buy 5 for $339.15 each and save 5%
  • Buy 21 for $321.3 each and save 10%
  • Buy 31 for $303.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04345
Size 50 µg
Host Insect cell
Accession
Molecular Weight 20.1kDa (180aa) 18-28KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRHHHHHH
Purity > 95% by HPLC
Concentration 1.0mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Cd40, B-cell surface antigen CD40, Bp50, CD40L receptor, CD antigen, Tnfrsf5
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap