Home / Products / proteins / Tumor necrosis factor receptor superfamily member 17, 1-54aa, Human, hIgG-His tag, Insect cell

Tumor necrosis factor receptor superfamily member 17, 1-54aa, Human, hIgG-His tag, Insect cell

Categories: [Proteins / Peptides]
TNFRSF17, also known as tumor necrosis factor receptor superfamily member 17, is a member of the TNF receptor superfamily. It is a receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL and promotes B-cell survival and plays a role in the regulation of humoral immunity. It activates NF-kappa-B and JNK. Recombinant human TNFRSF17, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $306
  • Buy 5 for $290.7 each and save 5%
  • Buy 21 for $275.4 each and save 10%
  • Buy 31 for $260.1 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04342
Size 50 µg
Host Insect cell
Accession
Molecular Weight 33.1Da (296aa), 40-57KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences ADPMLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNALEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names TNFRSF17, BCM, BCMA, CD269, TNFRSF13A
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap