Tumor necrosis factor, 80-235aa, Mouse, His tag, Insect cell

Categories: [Proteins / Peptides]
TNF, also known as tumor necrosis factor isoform 1, is the prototypic ligand of the TNF superfamily. It is a pleiotropic molecule that plays a central role in inflammation, apoptosis, and immune system development. This protein is produced by a wide variety of immune and epithelial cell types. It is assembled intracellularly to form a noncovalently linked homotrimer which is expressed on the cell surface. Cell surface TNF can induce the lysis of neighboring tumor cells and virus infected cells, and it can generate its own downstream cell signaling following ligation by soluble TNFR I. It also promotes inflammatory responses by inducing the activation of vascular endothelial cells and macrophages. Recombinant Mouse TNF, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04349
Size 50 µg
Host Insect cell
Accession
Molecular Weight 18.0kDa (162aa) 18-28kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIALHHHHHH
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4)
Other Names Tnf, DIF, TNF-a, TNF-alpha, Tnfa, TNFalpha, Tnfsf1a, TNFSF2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap