Home / Products / proteins / TTC11, 1-122aa, Human, His tag, E.coli

TTC11, 1-122aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission. This protein can induce cytochrome C release from the mitochondrion to the cytosol, ultimately leading to apoptosis. It is also involved in peroxisomal growth and division. The C terminus is required for mitochondrial localisation, while the N teminus is necessary for mitochondrial fission. Recombinant human TTC11, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04335
Size 100 µg
Host E.coli
Accession
Molecular Weight 16.3 kDa(142aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl Buffer (pH 8.0) containing 10% Glycerol
Other Names FIS1, Tetratricopeptide repeat domain 11 2010003O14Rik, CGI 135, CGI135, FIS 1, Fis1 homolog, FIS1, S, cerevisiae, homolog of, Fission 1 (mitochondrial outer membrane) homolog
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap