TSSK6, 1-273aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
TSSK6, also known as testis-specific serine/threonine-protein kinase 6, is a member of the CAMK Ser/Thr protein kinase family. This protein contains one protein kinase domain. It is highly expressed in the testis and lowly expressed in the colon, prostate, thymus, small intestine, and peripheral blood leukocytes. It interacts with the heatshock proteins HSPA8, HSPCB, and HAPA1A; these interactions appear to be required for TSSK6 kinase activity. It plays a role in DNA condensation during postmeiotic chromatin remodeling. Otherwise, TSSK6 is required for sperm production and function. Recombinant human TSSK6 protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04330
Size 100 µg
Host E.coli
Accession
Molecular Weight 32.7 kDa(296aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.4M Urea
Other Names Testis-specific serine kinase 6, CT72, FKSG82, SSTK, TSSK4
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap