TSG101, 1-145 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
TSG101(Tumor susceptibility gene 101) protein belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. This protein contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. Mutations and alternative splicing in this protein occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression. Recombinant human TSG101 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04321
Size 50 µg
Host E.coli
Accession
Molecular Weight 20.7 kDa (181aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 1mM DTT, 10% glycerol
Other Names TSG10, VPS23, Tumor susceptibility gene 101 ESCRT I complex subunit TSG101, TSG 10, TSG 101, Tumor susceptibility gene 10, Tumor susceptibility gene 101, Tumor susceptibility protein, Tumor susceptibility protein isoform 3, VPS 23, VPS23.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap