Home / Products / proteins / TSEN15, 1-171aa, Human, His tag, E.coli

TSEN15, 1-171aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
TSEN15 (tRNA-splicing endonuclease subunit Sen15) belongs to the SEN15 family. tRNA splicing is a fundamental process required for cell growth and division. SEN15 is a subunit of the tRNA splicing endonuclease. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. Recombinant human TSEN15 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04319
Size 50 µg
Host E.coli
Accession
Molecular Weight 20.9kDa (191aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMEERGDSEPTPGCSGLGPDGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATHVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2mM DTT, 20% glycerol, 200mM NaCl
Other Names tRNA-splicing endonuclease subunit Sen15, sen15, C1orf19
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap