Trypsin-3, 81-304aa, Human, His tag, Insect cell

Categories: [Proteins / Peptides]
PRSS3, also known as trypsin-3, is a member of the trypsin family of serine proteases. It is specialized for the degradation of trypsin inhibitors and may be involved in defensin processing, including DEFA5. This protein is expressed in the brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Compared to PRSS1 and 2, one intriguing feature of PRSS3 is its resistance to polypeptide trypsin inhibitors, such as the Kunitz-type soybean trypsin inhibitor or the Kazal-type pancreatic secretory trypsin inhibitor. Recombinant human PRSS3, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04317
Size 50 µg
Host Insect cell
Accession
Molecular Weight 25.3kDa (233aa) 28-40KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences ADPIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANSHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names PRSS3, MTG, PRSS4, T9, TRY3, TRY4
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap